General Information

  • ID:  hor003043
  • Uniprot ID:  Q8K4P1
  • Protein name:  Neuropeptide B-29
  • Gene name:  NPB
  • Organism:  Mus musculus (Mouse)
  • Family:  Neuropeptide B/W family
  • Source:  animal
  • Expression:  Detected in brain; more specifically in paraventricular hypothalamic nucleus, hippocampus and several nuclei in midbrain and brainstem.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Mus (subgenus), Mus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0001664 G protein-coupled receptor binding
  • GO BP:  GO:0007186 G protein-coupled receptor signaling pathway; GO:0007193 adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway; GO:0007218 neuropeptide signaling pathway; GO:0007631 feeding behavior
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  WYKPAAGPHHYSVGRASGLLSSFHRFPST
  • Length:  29
  • Propeptide:  MARCRTLVAAALALLLPPALAWYKPAAGPHHYSVGRASGLLSSFHRFPSTRRSESPALRVGTGPLRNLEMRPSVRSLALCVKDVTPNLQSCQRQLNSRGTFQCKADVFLSLHETDCQST
  • Signal peptide:  MARCRTLVAAALALLLPPALA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Has an effect in food intake, on locomotor activity and has an analgesic effect. May be involved in the regulation of neuroendocrine system, memory and learning
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  Npbwr1
  • Target Unid:  P49681
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-O49320-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    AF-O49320-F1.pdbhor003043_AF2.pdbhor003043_ESM.pdb

Physical Information

Mass: 371418 Formula: C149H213N43O38
Absent amino acids: CDEIMNQ Common amino acids: S
pI: 10.65 Basic residues: 6
Polar residues: 11 Hydrophobic residues: 9
Hydrophobicity: -47.93 Boman Index: -3880
Half-Life: 2.8 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 47.24
Instability Index: 4584.48 Extinction Coefficient cystines: 8480
Absorbance 280nm: 302.86

Literature

  • PubMed ID:  NA
  • Title:  NA