General Information

  • ID:  hor003040
  • Uniprot ID:  Q8NG41
  • Protein name:  Neuropeptide B-29
  • Gene name:  NPB
  • Organism:  Homo sapiens (Human)
  • Family:  Neuropeptide B/W family
  • Source:  Human
  • Expression:  Widely expressed in the central nervous system. High levels are found in substantia nigra, hypothalamus, hippocampus, spinal cord, placenta and fetal brain; lower levels are found in testis, uterus and ovary. Also detected at high levels in colorectal ade
  • Disease:  Diseases associated with NPB include Niemann-Pick Disease, Type B and Gallbladder Papillomatosis.
  • Comments:  NA
  • Taxonomy:  Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0001664 G protein-coupled receptor binding; GO:0005515 protein binding
  • GO BP:  GO:0007186 G protein-coupled receptor signaling pathway; GO:0007218 neuropeptide signaling pathway; GO:0007631 feeding behavior
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  WYKPAAGHSSYSVGRAAGLLSGLRRSPYA
  • Length:  29(25-53)
  • Propeptide:  MARSATLAAAALALCLLLAPPGLAWYKPAAGHSSYSVGRAAGLLSGLRRSPYARRSQPYRGAEPPGGAGASPELQLHPRLRSLAVCVQDVAPNLQRCERLPDGRGTYQCKANVFLSLRAADCLAA
  • Signal peptide:  MARSATLAAAALALCLLLAPPGLA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  May be involved in the regulation of feeding, neuroendocrine system, memory, learning and in the afferent pain pathway
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NPBWR1, NPBWR2
  • Target Unid:  P48145, P48146
  • IC50: NA
  • EC50: GPR7 :0.23 nM ; GPR8 : 15.8 nM
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q2HIM9-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-Q2HIM9-F1.pdbhor003040_AF2.pdbhor003040_ESM.pdb

Physical Information

Mass: 357907 Formula: C139H212N42O38
Absent amino acids: CDEFIMNQT Common amino acids: AS
pI: 10.77 Basic residues: 5
Polar residues: 12 Hydrophobic residues: 10
Hydrophobicity: -33.1 Boman Index: -3845
Half-Life: 2.8 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 67.59
Instability Index: 8227.24 Extinction Coefficient cystines: 9970
Absorbance 280nm: 356.07

Literature

  • PubMed ID:  12719537
  • Title:  Characterization of a Family of Endogenous Neuropeptide Ligands for the G Protein-Coupled Receptors GPR7 and GPR8