General Information

  • ID:  hor003038
  • Uniprot ID:  Q8MJV4
  • Protein name:  Neuropeptide B-29
  • Gene name:  NPB
  • Organism:  Bos taurus (Bovine)
  • Family:  Neuropeptide B/W family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Bos (genus), Bovinae (subfamily), Bovidae (family), Pecora (infraorder), Ruminantia (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0001664 G protein-coupled receptor binding
  • GO BP:  GO:0007186 G protein-coupled receptor signaling pathway; GO:0007218 neuropeptide signaling pathway; GO:0007631 feeding behavior
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  WYKPTAGQGYYSVGRAAGLLSGFHRSPYA
  • Length:  29
  • Propeptide:  MAGPAMLVAAALALCLLLASPGLAWYKPTAGQGYYSVGRAAGLLSGFHRSPYARRSEPRGGTRSLGGVGTFREMRPNLRSLAVCVEEVTPNLQSCEPLPDGRATFQCKADVFLSLSASDCRK
  • Signal peptide:  MAGPAMLVAAALALCLLLASPGLA
  • Modification:  T1 6'-bromotryptophan
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  May be involved in the regulation of feeding, neuroendocrine system, memory, learning and in the afferent pain pathway
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NPBWR1, NPBWR2
  • Target Unid:  Q8MJV3, Q8MJV2
  • IC50: NA
  • EC50: GPR7 :0.23 nM ; GPR8 : 15.8 nM
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q6NME6-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    AF-Q6NME6-F1.pdbhor003038_AF2.pdbhor003038_ESM.pdb

Physical Information

Mass: 366113 Formula: C147H210N40O39
Absent amino acids: CDEIMN Common amino acids: G
pI: 10.05 Basic residues: 4
Polar residues: 13 Hydrophobic residues: 9
Hydrophobicity: -42.07 Boman Index: -2779
Half-Life: 2.8 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 50.69
Instability Index: 4392.41 Extinction Coefficient cystines: 11460
Absorbance 280nm: 409.29

Literature

  • PubMed ID:  12118011
  • Title:  Identification of a Neuropeptide Modified With Bromine as an Endogenous Ligand for GPR7