General Information

  • ID:  hor003034
  • Uniprot ID:  P81872
  • Protein name:  Neuromedin-U-23
  • Gene name:  nmu
  • Organism:  Ranoidea caerulea (Green tree frog) (Litoria caerulea)
  • Family:  NmU family
  • Source:  Animal
  • Expression:  Skin.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Ranoidea (genus), Pelodryadinae (subfamily), Hylidae (family), Hyloidea (superfamily), Neobatrachia (suborder), Anura (order), Batrachia (superorder), Amphibia (class), Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0042922 neuromedin U receptor binding
  • GO BP:  GO:0006940 regulation of smooth muscle contraction; GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  SDEEVQVPGGVISNGYFLFRPRN
  • Length:  23(145-167)
  • Propeptide:  MQKGSEDTTQNRCHQHSIGGHSTCGLLLLIILVSWTSICEGAPFSSPVLGAEDELPLWNGIDDACSAVLPDPQLAVSSTLRELCFMVMRMQQKSQGEEKDDFKRFLFHYSKSHDSGNSDITSSVLHPLLQLLPQLHDRRMKRLTSDEEVQVPGGVISNGYFLFRPRNGRRSAGFR
  • Signal peptide:  MQKGSEDTTQNRCHQHSIGG
  • Modification:  T23 Asparagine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulates uterine smooth muscle contraction and causes selective vasoconstriction.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9SRY3-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-Q9SRY3-F1.pdbhor003034_AF2.pdbhor003034_ESM.pdb

Physical Information

Mass: 297341 Formula: C115H174N32O36
Absent amino acids: ACHKMTW Common amino acids: GV
pI: 4.43 Basic residues: 2
Polar residues: 8 Hydrophobic residues: 7
Hydrophobicity: -46.96 Boman Index: -4720
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 71.74
Instability Index: 3443.48 Extinction Coefficient cystines: 1490
Absorbance 280nm: 67.73

Literature

  • PubMed ID:  10671478
  • Title:  Isolation, Structural Characterization, and Bioactivity of a Novel Neuromedin U Analog From the Defensive Skin Secretion of the Australasian Tree Frog, Litoria Caerulea