General Information

  • ID:  hor003032
  • Uniprot ID:  P12760(144-166)
  • Protein name:  Neuromedin-U-23
  • Gene name:  Nmu
  • Organism:  Rattus norvegicus (Rat)
  • Family:  NmU family
  • Source:  animal
  • Expression:  Expressed throughout the gastrointestinal tract with highest levels in the duodenum and jejunum .
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Rattus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0031839 type 1 neuromedin U receptor binding; GO:0031840 type 2 neuromedin U receptor binding; GO:0042922 neuromedin U receptor binding
  • GO BP:  GO:0001659 temperature homeostasis; GO:0001696 gastric acid secretion; GO:0003084 positive regulation of systemic arterial blood pressure; GO:0006940 regulation of smooth muscle contraction; GO:0007204 positive regulation of cytosolic calcium ion concentration; GO:0007218 neuropeptide signaling pathway; GO:0009648 photoperiodism; GO:0010460 positive regulation of heart rate; GO:0031652 positive regulation of heat generation; GO:0042755 eating behavior; GO:0045187 regulation of circadian sleep/wake cycle, sleep; GO:0045987 positive regulation of smooth muscle contraction; GO:0046887 positive regulation of hormone secretion; GO:0050806 positive regulation of synaptic transmission; GO:0060259 regulation of feeding behavior; GO:0060455 negative regulation of gastric acid secretion; GO:0097009 energy homeostasis; GO:0120061 negative regulation of gastric emptying; GO:0120069 positive regulation of stomach fundus smooth muscle contraction; GO:1902722 positive regulation of prolactin secretion; GO:1903999 negative regulation of eating behavior; GO:1904058 positive regulation of sensory perception of pain; GO:2000252 negative regulation of feeding behavior; GO:2000821 regulation of grooming behavior
  • GO CC:  GO:0005576 extracellular region; GO:0043195 terminal bouton

Sequence Information

  • Sequence:  YKVNEYQGPVAPSGGFFLFRPRN
  • Length:  23(144-166)
  • Propeptide:  MSRAANRRPGLSAGQLAAATASPLLSLLLLLACCADACRGTPISPQRLPPEQELQLWNEIPEACASFLSVDSQPQASVALRKLCRVLMEIFQKPQEQTEKDNAKRFLFHYSKTQKLGNSNVVSSVVHPLLQLVPQLHERRMKRYKVNEYQGPVAPSGGFFLFRPRNGKRSTSFI
  • Signal peptide:  MSRAANRRPGLSAGQLAAATASPLLSLLLLLACCADA
  • Modification:  T23 Asparagine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Receptor-binding is very tight if not irreversible and triggers an increase in the cytosolic Ca2+ concentration. Stimulates muscle contractions of specific regions of the gastrointestinal tract. In rat, NMU stimulates contractions of stomach circular musc
  • Mechanism:  NA
  • Cross BBB:  YES
  • Target:  Nmur1, Nmur2
  • Target Unid:  Q9JJI5, Q9ESQ4
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q84MD2-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-Q84MD2-F1.pdbhor003032_AF2.pdbhor003032_ESM.pdb

Physical Information

Mass: 303655 Formula: C124H179N33O32
Absent amino acids: CDHIMTW Common amino acids: FGP
pI: 10.01 Basic residues: 3
Polar residues: 8 Hydrophobic residues: 7
Hydrophobicity: -60.43 Boman Index: -3813
Half-Life: 2.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: 2 min Aliphatic Index 46.52
Instability Index: 4682.17 Extinction Coefficient cystines: 2980
Absorbance 280nm: 135.45

Literature

  • PubMed ID:  3178840
  • Title:  Isolation and Structural Determination of Rat Neuromedin U
  • PubMed ID:  3411332
  • Title:   Primary Structure of Neuromedin U From the Rat
  • PubMed ID:  7916966
  • Title:   Distribution and Developmental Pattern of Neuromedin U Expression in the Rat Gastrointestinal Tract