General Information

  • ID:  hor003031
  • Uniprot ID:  Q5H8A2
  • Protein name:  Neuromedin-S
  • Gene name:  NMS
  • Organism:  Rattus norvegicus (Rat)
  • Family:  NmU family
  • Source:  animal
  • Expression:  Expression has a diurnal peak under light/dark cycling, but remains stable under constant darkness. |Expressed in the CNS, spleen and testis. Specifically expressed in the suprachiasmatic nuclei (SCN) of the hypothalamus.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Rattus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0001664 G protein-coupled receptor binding
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0045475 locomotor rhythm
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  LPRLLHTDSRMATIDFPKKDPTTSLGRPFFLFRPRN
  • Length:  36
  • Propeptide:  MKHPFPQFPPILVIYCFCMLQIPSSGASPPLAGPPDGLDAVDPERLAHFLNQRETCSNQPKESRDVYKRFLFHYSRAWKSTHPVNSEFAPVHPLMRLAAKLPSRRMKRLPRLLHTDSRMATIDFPKKDPTTSLGRPFFLFRPRNGRYTDKVQ
  • Signal peptide:  MKHPFPQFPPILVIYCFCMLQIPSSG
  • Modification:  T36 Asparagine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Implicated in the regulation of circadian rhythms through autocrine and/or paracrine actions. Stimulates the contraction of rectum and elevation of blood pressure.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  Nmur2, Nmur1
  • Target Unid:  Q9ESQ4, Q9JJI5
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q6DUW9-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    AF-Q6DUW9-F1.pdbhor003031_AF2.pdbhor003031_ESM.pdb

Physical Information

Mass: 486740 Formula: C193H306N56O50S
Absent amino acids: CEQVWY Common amino acids: LPR
pI: 11.96 Basic residues: 8
Polar residues: 8 Hydrophobic residues: 11
Hydrophobicity: -60.83 Boman Index: -9370
Half-Life: 5.5 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 67.78
Instability Index: 4565 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  15635449
  • Title:  Identification of neuromedin S and its possible role in the mammalian circadian oscillator system.