General Information

  • ID:  hor003029
  • Uniprot ID:  Q5H8A1
  • Protein name:  Neuromedin-S
  • Gene name:  NMS
  • Organism:  Mus musculus (Mouse)
  • Family:  NmU family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Mus (subgenus), Mus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0001664 G protein-coupled receptor binding
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0045475 locomotor rhythm
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  LPRLLRLDSRMATVDFPKKDPTTSLGRPFFLFRPRN
  • Length:  36
  • Propeptide:  MKHPLPHYSPILFIYCFCMLQIPSSGASPPLADSPDGLDIVDPERLAYFLKQREIHSNQPKENQDVYKRFLFHYSRTRKPTHPVSAEFAPVHPLMRLAAKLASRRMKRLPRLLRLDSRMATVDFPKKDPTTSLGRPFFLFRPRNGRYTDNNFQ
  • Signal peptide:  MKHPLPHYSPILFIYCFCMLQIPSSG
  • Modification:  T36 Asparagine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Implicated in regulation of circadian rhythm and feeding behavior. May regulate cardiovascular function by activating the sympathetic nervous system.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  Nmur2
  • Target Unid:  Q8BZ39
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q6DUW7-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    AF-Q6DUW7-F1.pdbhor003029_AF2.pdbhor003029_ESM.pdb

Physical Information

Mass: 488447 Formula: C194H313N57O49S
Absent amino acids: CEHIQWY Common amino acids: LR
pI: 12.22 Basic residues: 8
Polar residues: 7 Hydrophobic residues: 12
Hydrophobicity: -52.78 Boman Index: -9735
Half-Life: 5.5 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 75.83
Instability Index: 4891.94 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  17870195
  • Title:  Identification and Functional Analysis of a Novel Ligand for G Protein-Coupled Receptor, Neuromedin S
  • PubMed ID:  21356261
  • Title:   Neuromedin S Regulates Cardiovascular Function Through the Sympathetic Nervous System in Mice