General Information

  • ID:  hor003027
  • Uniprot ID:  Q5H8A3
  • Protein name:  Neuromedin-S
  • Gene name:  NMS
  • Organism:  Homo sapiens (Human)
  • Family:  NmU family
  • Source:  Human
  • Expression:  NA
  • Disease:  Diseases associated with NMS include Type 1 Diabetes Mellitus 2.
  • Comments:  NA
  • Taxonomy:  Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0001664 G protein-coupled receptor binding
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0045475 locomotor rhythm
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  ILQRGSGTAAVDFTKKDHTATWGRPFFLFRPRN
  • Length:  33(109-141)
  • Propeptide:  MKHLRPQFPLILAIYCFCMLQIPSSGFPQPLADPSDGLDIVQLEQLAYCLSQWAPLSRQPKDNQDIYKRFLFHYSRTQEATHPVKTGFPPVHPLMHLAAKLANRRMKRILQRGSGTAAVDFTKKDHTATWGRPFFLFRPRNGRNIEDEAQIQW
  • Signal peptide:  MKHLRPQFPLILAIYCFCMLQIPSSG
  • Modification:  T33 Asparagine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Implicated in the regulation of circadian rhythms through autocrine and/or paracrine actions.;act as potent vasoconstrictors
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NMUR2, NMUR1
  • Target Unid:   Q9GZQ4, Q9HB89
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q6DUW8-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-Q6DUW8-F1.pdbhor003027_AF2.pdbhor003027_ESM.pdb

Physical Information

Mass: 436327 Formula: C173H264N52O45
Absent amino acids: CEMY Common amino acids: FRT
pI: 12.08 Basic residues: 7
Polar residues: 9 Hydrophobic residues: 12
Hydrophobicity: -57.58 Boman Index: -7744
Half-Life / Aliphatic Index: 20 hour Aliphatic Index: 53.33
Instability Index: 2240.91 Extinction Coefficient cystines: 5500
Absorbance 280nm: 171.88

Literature

  • PubMed ID:  18987052
  • Title:  Expression and Vasoconstrictor Function of Anorexigenic Peptides Neuromedin U-25 and S in the Human Cardiovascular System