General Information

  • ID:  hor002982
  • Uniprot ID:  P07501
  • Protein name:  Atrial natriuretic peptide
  • Gene name:  NPPA
  • Organism:  Bos taurus (Bovine)
  • Family:  Natriuretic peptide family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Bos (genus), Bovinae (subfamily), Bovidae (family), Pecora (infraorder), Ruminantia (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005102 signaling receptor binding; GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity; GO:0051427 hormone receptor binding; GO:0071855 neuropeptide receptor binding
  • GO BP:  GO:0003008 system process; GO:0003085 negative regulation of systemic arterial blood pressure; GO:0006182 cGMP biosynthetic process; GO:0006457 protein folding; GO:0007168 receptor guanylyl cyclase signaling pathway; GO:0007218 neuropeptide signaling pathway; GO:0007565 female pregnancy; GO:0008217 regulation of blood pressure; GO:0010460 positive regulation of heart rate; GO:0014898 cardiac muscle hypertrophy in response to stress; GO:0019934 cGMP-mediated signaling; GO:0036376 sodium ion export across plasma membrane; GO:0042311 vasodilation; GO:0045776 negative regulation of blood pressure; GO:0060372 regulation of atrial cardiac muscle cell membrane repolarization; GO:0060452 positive regulation of cardiac muscle contraction; GO:0097746 blood vessel diameter maintenance; GO:1903766 positive regulation of potassium ion export across plasma membrane
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0005737 cytoplasm; GO:0032991 protein-containing complex; GO:0042995 cell projection; GO:0043204 perikaryon

Sequence Information

  • Sequence:  SLRRSSCFGGRMDRIGAQSGLGCNSFRY
  • Length:  28(123-150)
  • Propeptide:  MGSSAITVSFLLFLAFQLPGQTGANPVYGSVSNADLMDFKNLLDRLEDKMPLEDEAVPSQVLSEQNEEAGAPLSPLSEMPPWMGEVNPAQREGGVLGRGPWESSDRSALLKSKLRALLTAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRYRR
  • Signal peptide:  MGSSAITVSFLLFLAFQLPGQTGA
  • Modification:  T6 Phosphoserine
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Hormone that plays a key role in mediating cardio-renal homeostasis, and is involved in vascular remodeling and regulating energy metabolism . Acts by specifically binding and stimulating NPR1 to produce cGMP, which in turn activates effector proteins, su
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NPR1, NPR3
  • Target Unid:  E1BN71, P10730
  • IC50: IC50=59pM, Inhibition of aldosterone production ( PubMed ID: 2942845 )
  • EC50: NA
  • ED50: NA
  • kd: Kd=10pM for receptor binding ( PubMed ID: 11054637 )
  • Half life: 22 minutes; /1320 seconds ( PubMed ID: 11054637 )

Structure

  • Disulfide bond:  45861
  • Structure ID:  AF-P07501-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002982_AF2.pdbhor002982_ESM.pdb

Physical Information

Mass: 356424 Formula: C127H205N45O39S3
Absent amino acids: EHKPTVW Common amino acids: GRS
pI: 10.95 Basic residues: 5
Polar residues: 14 Hydrophobic residues: 6
Hydrophobicity: -49.64 Boman Index: -8050
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 45.36
Instability Index: 8255.36 Extinction Coefficient cystines: 1615
Absorbance 280nm: 59.81

Literature

  • PubMed ID:  3007908
  • Title:  Purification and Sequence Determination of Bovine Atrial Natriuretic Factor
  • PubMed ID:  11054637
  • Title:  Delayed metabolism of human brain natriuretic peptide reflects resistance to neutral endopeptidase
  • PubMed ID:  2942845
  • Title:   Disappearance of atrial natriuretic factor from circulation in the rat