General Information

  • ID:  hor002981
  • Uniprot ID:  Q805D3
  • Protein name:  C-type natriuretic peptide 4
  • Gene name:  cnp-4
  • Organism:  Takifugu rubripes (Japanese pufferfish) (Fugu rubripes)
  • Family:  Natriuretic peptide family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Takifugu (genus), Tetraodontidae (family), Tetradontoidea (superfamily), Tetraodontoidei (suborder), Tetraodontiformes (order), Eupercaria, Percomorphaceae, Euacanthomorphacea, Acanthomorphata, Ctenosquamata, Eurypterygia, Neoteleostei, Euteleosteomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0097746 blood vessel diameter maintenance
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  GGSSRSGCFGHKMDRIGTISGMGC
  • Length:  24
  • Propeptide:  MNLSYLVACGLMITLLSVRMGAKPLSQAQQKSFRSLLGEELAEFLESEEKERRLDAVRSRLRLLRDLRMDTRARGVWARLLNDQPVPRRHKTGIKKGGSSRSGCFGHKMDRIGTISGMGC
  • Signal peptide:  MNLSYLVACGLMITLLSVRMGA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Exhibits natriuretic and vasodepressant activity. Has cGMP-stimulating activity. May help to regulate body fluid homeostasis in a variety of aquatic environments.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NPR2, npr3
  • Target Unid:  H2TS20, H2UDQ0
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  8-24
  • Structure ID:  AF-Q805D3-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor002981_AF2.pdbhor002981_ESM.pdb

Physical Information

Mass: 281216 Formula: C95H157N33O32S4
Absent amino acids: AELNPQVWY Common amino acids: G
pI: 8.83 Basic residues: 4
Polar residues: 14 Hydrophobic residues: 3
Hydrophobicity: -23.75 Boman Index: -3828
Half-Life: 30 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 32.5
Instability Index: 6585.42 Extinction Coefficient cystines: 125
Absorbance 280nm: 5.43

Literature

  • PubMed ID:  12893874
  • Title:  Four Functionally Distinct C-type Natriuretic Peptides Found in Fish Reveal Evolutionary History of the Natriuretic Peptide System