HORDB

ID: hor002976
Uniprot ID: D1MZV3
Protein name: Natriuretic peptide
Gene name: NA
Organism: Rhabdophis tigrinus tigrinus (Tiger keelback snake)
Family: Natriuretic peptide family
Source: Animal
Expression: Expressed by the venom gland.
Disease: NA
Comments: NA
Taxonomy: Rhabdophis tigrinus (species), Rhabdophis (genus), Natricinae (subfamily), Colubridae (family), Colubroidea (superfamily), Serpentes (infraorder), Toxicofera, Episquamata, Unidentata, Bifurcata, Squamata (order), Lepidosauria (class), Sauria, Sauropsida, Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity; GO:0090729 toxin activity
GO BP: GO:0007165 signal transduction; GO:0008217 regulation of blood pressure; GO:0035821 modulation of process of another organism; GO:0042311 vasodilation; GO:0097746 blood vessel diameter maintenance
GO CC: GO:0005576 extracellular region

Sequence: GLPKKGLGSGCFGLKLDRIGSMSGLGC
Length: 27(135-161)
Propeptide: MFASRLAALGLLLLALVLDGKPAPPPQPLRKAPAGGTTALQRQLTEQQQQQQQAEGSSGPAAGGGGGRSGSKTANAAPTAPKSKGAAASAASRLLRDLRPDGKQSRAAWGRMVHPEHHAGGGGGGGGGGSRRLKGLPKKGLGSGCFGLKLDRIGSMSGLGC
Signal peptide: MFASRLAALGLLLLALVLDGKP
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: Snake venom natriuretic peptide that exhibits hypotensive and vasodepressor activity.
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor002976_AF2.pdb

hor002976_ESM.pdb

Mass:	311614	Formula:	C114H195N33O33S3
Absent amino acids:	AEHNQTVWY	Common amino acids:	G
pI:	9.67	Basic residues:	4
Polar residues:	13	Hydrophobic residues:	7
Hydrophobicity:	23.33	Boman Index:	-556
Half-Life:	30 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	86.67
Instability Index:	2081.11	Extinction Coefficient cystines:	125
Absorbance 280nm:	4.81