General Information

  • ID:  hor002974
  • Uniprot ID:  Q800I7
  • Protein name:  C-type natriuretic peptide 4
  • Gene name:  cnp-4
  • Organism:  Oryzias latipes (Japanese rice fish) (Japanese killifish)
  • Family:  Natriuretic peptide family
  • Source:  animal
  • Expression:  Brain, spinal cord, spleen, heart and fin, and to a lower extent in gill and ovary.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Oryzias (genus), Oryziinae (subfamily), Adrianichthyidae (family), Adrianichthyoidei (suborder), Beloniformes (order), Atherinomorphae (superorder), Ovalentaria, Percomorphaceae, Euacanthomorphacea, Acanthomorphata, Ctenosquamata, Eurypterygia, Neoteleostei, Euteleosteomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0051427 hormone receptor binding
  • GO BP:  GO:0006182 cGMP biosynthetic process; GO:0007168 receptor guanylyl cyclase signaling pathway; GO:0097746 blood vessel diameter maintenance
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  GGSTSRSGCFGHKMDRIGTISGMGC
  • Length:  25
  • Propeptide:  MNLSYLVACGLLVTFLSDKMDAQPLTPAQQKSLRSLLGEELAEFLESGENENRLDDVRSRMRLLRDLRVDTRARGMWARLLNDQPASRRHKSGSKKGGSTSRSGCFGHKMDRIGTISGMGC
  • Signal peptide:  MNLSYLVACGLLVTFLSDKMDA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Exhibits natriuretic and vasodepressant activity. Has cGMP-stimulating activity. May help to regulate body fluid homeostasis in a variety of aquatic environments.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  npr-c, npr2
  • Target Unid:  H2MS28, A0A3B3H6G0
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  9-25
  • Structure ID:  AF-Q3ECU1-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    AF-Q3ECU1-F1.pdbhor002974_AF2.pdbhor002974_ESM.pdb

Physical Information

Mass: 293110 Formula: C99H164N34O34S4
Absent amino acids: AELNPQVWY Common amino acids: G
pI: 8.83 Basic residues: 4
Polar residues: 15 Hydrophobic residues: 3
Hydrophobicity: -25.6 Boman Index: -4085
Half-Life: 30 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 31.2
Instability Index: 5591.6 Extinction Coefficient cystines: 125
Absorbance 280nm: 5.21

Literature

  • PubMed ID:  12893874
  • Title:  Four Functionally Distinct C-type Natriuretic Peptides Found in Fish Reveal Evolutionary History of the Natriuretic Peptide System