General Information

  • ID:  hor002972
  • Uniprot ID:  P40756
  • Protein name:  C-type natriuretic peptide 2
  • Gene name:  NA
  • Organism:  Lithobates catesbeianus (American bullfrog) (Rana catesbeiana)
  • Family:  Natriuretic peptide family
  • Source:  Animal
  • Expression:  brain
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Lithobates (genus), Ranidae (family), Ranoidea (superfamily), Neobatrachia (suborder), Anura (order), Batrachia (superorder), Amphibia (class), Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0097746 blood vessel diameter maintenance
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  GTSKGCFGLKLDRIGAMSGLGC
  • Length:  22(97-118)
  • Propeptide:  MHFCHIVGWGLVLAVLYLRTEAKPVAQAHQKSLRALLGEELAEYLVSGERGERSIDPKTRARLLRDIRADTRSRAAWTRLLNEHPNSRKIKGINKKGTSKGCFGLKLDRIGAMSGLGC
  • Signal peptide:  MHFCHIVGWGLVLAVLYLRTEA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Exhibits natriuretic and vasodepressor activity. Has a cGMP-stimulating activity.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  45830
  • Structure ID:  AF-Q8S8N0-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-Q8S8N0-F1.pdbhor002972_AF2.pdbhor002972_ESM.pdb

Physical Information

Mass: 254635 Formula: C91H155N27O28S3
Absent amino acids: EHNPQVWY Common amino acids: G
pI: 8.82 Basic residues: 3
Polar residues: 11 Hydrophobic residues: 6
Hydrophobicity: 31.36 Boman Index: -909
Half-Life / Aliphatic Index: 30 hour Aliphatic Index: 75.45
Instability Index: 679.55 Extinction Coefficient cystines: 125
Absorbance 280nm: 5.95

Literature

  • PubMed ID:  8175740
  • Title:  Cloning and Characterization of a Novel Natriuretic Peptide in Frog (Rana Catesbeiana)