General Information

  • ID:  hor002971
  • Uniprot ID:  P16859
  • Protein name:  Brain natriuretic peptide 29
  • Gene name:  NPPB
  • Organism:  Canis lupus familiaris (Dog) (Canis familiaris)
  • Family:  Natriuretic peptide family
  • Source:  Animal
  • Expression:  Brain and also in atria, but at much lower levels than ANP.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Canis lupus (species), Canis (genus), Canidae (family), Caniformia (suborder), Carnivora (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0051427 hormone receptor binding
  • GO BP:  GO:0003008 system process; GO:0003085 negative regulation of systemic arterial blood pressure; GO:0006182 cGMP biosynthetic process; GO:0007168 receptor guanylyl cyclase signaling pathway; GO:0007218 neuropeptide signaling pathway; GO:0019934 cGMP-mediated signaling; GO:0097746 blood vessel diameter maintenance
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0005737 cytoplasm

Sequence Information

  • Sequence:  MMHKSGCFGRRLDRIGSLSGLGCNVLRKY
  • Length:  29(112-140)
  • Propeptide:  MEPCAALPRALLLLLFLHLSPLGGRPHPLGGRSPASEASEASEASGLWAVQELLGRLKDAVSELQAEQLALEPLHRSHSPAEAPEAGGTPRGVLAPHDSVLQALRRLRSPKMMHKSGCFGRRLDRIGSLSGLGCNVLRKY
  • Signal peptide:  MEPCAALPRALLLLLFLHLSPLGGRP
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Hormone which plays a role in endochondral ossification through regulation of cartilaginous growth plate chondrocytes proliferation and differentiation. May also be vasoactive and natriuretic.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  45861
  • Structure ID:  AF-Q3ECD6-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-Q3ECD6-F1.pdbhor002971_AF2.pdbhor002971_ESM.pdb

Physical Information

Mass: 375550 Formula: C138H232N46O37S4
Absent amino acids: AEPQTW Common amino acids: G
pI: 10.86 Basic residues: 7
Polar residues: 12 Hydrophobic residues: 7
Hydrophobicity: -21.38 Boman Index: -5756
Half-Life: 30 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 77.24
Instability Index: 6037.24 Extinction Coefficient cystines: 1615
Absorbance 280nm: 57.68

Literature

  • PubMed ID:  NA
  • Title:  NA