General Information

  • ID:  hor002961
  • Uniprot ID:  Q9BZL1
  • Protein name:  Ubiquitin-like protein 5
  • Gene name:  Ubl5
  • Organism:  Homo sapiens (Human)
  • Family:  NA
  • Source:  Human
  • Expression:  Ubiquitous. Highest level of expression in heart, skeletal muscle, kidney, liver, iris and lymphoblasts.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005515 protein binding; GO:0031386 protein tag activity
  • GO BP:  GO:0000398 mRNA splicing, via spliceosome; GO:0036211 protein modification process; GO:1903955 positive regulation of protein targeting to mitochondrion
  • GO CC:  GO:0005634 nucleus; GO:0005654 nucleoplasm; GO:0005737 cytoplasm; GO:0015030 Cajal body

Sequence Information

  • Sequence:  MIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDYEIHDGMNLELYYQ
  • Length:  73(1-73)
  • Propeptide:  MIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDYEIHDGMNLELYYQ
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Regulation of energy balance and body weight homeostasis
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-A0MH06-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-A0MH06-F1.pdbhor002961_AF2.pdbhor002961_ESM.pdb

Physical Information

Mass: 983142 Formula: C383H611N103O110S4
Absent amino acids: P Common amino acids: K
pI: 8.7 Basic residues: 14
Polar residues: 21 Hydrophobic residues: 24
Hydrophobicity: -41.51 Boman Index: -12853
Half-Life: 30 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 96.03
Instability Index: 1531.1 Extinction Coefficient cystines: 17085
Absorbance 280nm: 237.29

Literature

  • PubMed ID:  NA
  • Title:  NA