General Information

  • ID:  hor002953
  • Uniprot ID:  P91302
  • Protein name:  Ubiquitin-like protein 5
  • Gene name:  ubl-5
  • Organism:  Caenorhabditis elegans
  • Family:  NA
  • Source:  Animal
  • Expression:  Expression increased by citrate dietary supplementation.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Caenorhabditis (genus), Peloderinae (subfamily), Rhabditidae (family), Rhabditoidea (superfamily), Rhabditomorpha (infraorder), Rhabditina (suborder), Rhabditida (order), Chromadorea (class), Nematoda (phylum), Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0031386 protein tag activity
  • GO BP:  GO:0000398 mRNA splicing, via spliceosome; GO:0010628 positive regulation of gene expression; GO:0034514 mitochondrial unfolded protein response; GO:0036211 protein modification process
  • GO CC:  GO:0005634 nucleus; GO:0005667 transcription regulator complex; GO:0005737 cytoplasm; GO:0005829 cytosol

Sequence Information

  • Sequence:  MIEITVNDRLGKKVRIKCNPSDTIGDLKKLIAAQTGTRWEKIVLKKWYTIYKDHITLMDYEIHEGFNFELYYQ
  • Length:  73(1-73)
  • Propeptide:  MIEITVNDRLGKKVRIKCNPSDTIGDLKKLIAAQTGTRWEKIVLKKWYTIYKDHITLMDYEIHEGFNFELYYQ
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Involved in the mitochondrial unfolded protein response (mtUPR) (PubMed:17925224). Plays a role in modulation of lipid metabolism in response to the citrate-induced mtUPR, acting upstream of transcription factor nhr-80 (PubMed:35021096).
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q6IWB2-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-Q6IWB2-F1.pdbhor002953_AF2.pdbhor002953_ESM.pdb

Physical Information

Mass: 1002265 Formula: C400H628N102O111S3
Absent amino acids: Common amino acids: IK
pI: 9.01 Basic residues: 14
Polar residues: 20 Hydrophobic residues: 24
Hydrophobicity: -44.66 Boman Index: -12230
Half-Life / Aliphatic Index: 30 hour Aliphatic Index: 94.79
Instability Index: 2167.26 Extinction Coefficient cystines: 18450
Absorbance 280nm: 256.25

Literature

  • PubMed ID:  NA
  • Title:  NA