General Information

  • ID:  hor002948
  • Uniprot ID:  P85831
  • Protein name:  Brain peptide IDLSRFYGHFN
  • Gene name:  NA
  • Organism:  Apis mellifera (Honeybee)
  • Family:  NA
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Apis (genus), Apini (tribe), Apinae (subfamily), Apidae (family), Apoidea (superfamily), Aculeata (infraorder), Apocrita (suborder), Hymenoptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  IDLSRFYGHFN
  • Length:  11(29-39)
  • Propeptide:  MVQRLCTSVAALSLALSACVFFPRAVMAIDLSRFYGHFNTKRSGDACRPYEPFKCPGDDTCISIQYLCDGAPDCQDGYDEDSRLCTAAKRPPVEETASFLQSLLASHGPNYLEKLFGTKARDTLKPLGGVNTVAIALSESQTIEDFGAALHLLRTDLEHLRSVFMAVENGDLGMLKSIGIKDSELGDVKFFLEKLVKTGFLD
  • Signal peptide:  MVQRLCTSVAALSLALSACVFFPRAVMA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P85831-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002948_AF2.pdbhor002948_ESM.pdb

Physical Information

Mass: 154706 Formula: C64H89N17O17
Absent amino acids: ACEKMPQTVW Common amino acids: F
pI: 7.54 Basic residues: 2
Polar residues: 4 Hydrophobic residues: 4
Hydrophobicity: -30 Boman Index: -2174
Half-Life / Aliphatic Index: 20 hour Aliphatic Index: 70.91
Instability Index: 3909.09 Extinction Coefficient cystines: 1490
Absorbance 280nm: 149

Literature

  • PubMed ID:  19576913
  • Title:  Mass Spectrometric Profiling of (Neuro)-Peptides in the Worker Honeybee, Apis Mellifera.
  • PubMed ID:  17068263
  • Title:  From the Genome to the Proteome: Uncovering Peptides in the Apis Brain