General Information

  • ID:  hor002940
  • Uniprot ID:  Q06601
  • Protein name:  Apidaecin-1
  • Gene name:  APID14
  • Organism:  Apis mellifera (Honeybee)
  • Family:  Apidaecin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Apis (genus), Apini (tribe), Apinae (subfamily), Apidae (family), Apoidea (superfamily), Aculeata (infraorder), Apocrita (suborder), Hymenoptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0002376 immune system process; GO:0042742 defense response to bacterium; GO:0045087 innate immune response
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  GNNRPVYIPQPRPPHPRL
  • Length:  18(99-116)
  • Propeptide:  MKNFALAILVVTFVVAVFGNTNLDPPTRPARLRREAKPEAEPGNNRPIYIPQPRPPHPRLRREAEPKAEPGNNRPIYIPQPRPPHPRLRREAESEAEPGNNRPVYIPQPRPPHPRLRREPEAEPGNNRPVYIPQPRPPHPRLRREPEAEPGNNRPVYIPQPRPPHPRI
  • Signal peptide:  MKNFALAILVVTFVVAVFG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Apidaecins have bactericidal activity; predominantly against Gram-negative bacteria. They seem to interfere with cell propagation.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-D4A540-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-D4A540-F1.pdbhor002940_AF2.pdbhor002940_ESM.pdb

Physical Information

Mass: 241182 Formula: C95H150N32O23
Absent amino acids: ACDEFKMSTW Common amino acids: P
pI: 12.2 Basic residues: 4
Polar residues: 4 Hydrophobic residues: 3
Hydrophobicity: -144.44 Boman Index: -5356
Half-Life / Aliphatic Index: 30 hour Aliphatic Index: 59.44
Instability Index: 5316.11 Extinction Coefficient cystines: 1490
Absorbance 280nm: 87.65

Literature

  • PubMed ID:  19576913
  • Title:  Mass Spectrometric Profiling of (Neuro)-Peptides in the Worker Honeybee, Apis Mellifera.
  • PubMed ID:  2676519
  • Title:   Apidaecins: Antibacterial Peptides From Honeybees.
  • PubMed ID:  7929322
  • Title:  Biodiversity of Apidaecin-Type Peptide Antibiotics. Prospects of Manipulating the Antibacterial Spectrum and Com