General Information

  • ID:  hor002938
  • Uniprot ID:  P35905
  • Protein name:  Fulicin
  • Gene name:  NA
  • Organism:  Lissachatina fulica (Giant African land snail) (Achatina fulica)
  • Family:  NA
  • Source:  animal
  • Expression:  Found in central ganglia and the ventricles and atria of the heart.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Lissachatina (genus), Achatinidae (family), Achatinoidea (superfamily), Helicina, Stylommatophora (order), Eupulmonata (superorder), Panpulmonata, Euthyneura, Heterobranchia (subclass), Gastropoda (class), Mollusca (phylum), Lophotrochozoa, Spiralia, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  NA

Sequence Information

  • Sequence:  FNEFV
  • Length:  5(122-126)
  • Propeptide:  MQPTVLLILMTSCLTYQVIADKPKGNHLHSRPERSPIVLFSDAPHAAASPADENDNFPVLKTANQYEDNNSATFSHLEEKHDFAEKQSTGDDEESVILNRVTGEVLSDTVDGSQGHLEPKRFNEFVGKRNTLPEEAGSFDADSQPGSLDTVRILAGLSNFGQPQIIDQGNMKNHRTLKNMIHNLYNTMNEDEASKRQYEFVGKRSYDFVGKRTYDFLGKRSPYYFLGKRYDFIGKRSPYDFIGKKNYDFVGKRSP
  • Signal peptide:  MQPTVLLILMTSCLTYQ
  • Modification:  T2 D-asparagine;T5 Valine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Potentiates tetanic contraction of the penis retractor muscle at very low concentrations, and also shows modulatory actions on the activity of the buccal and ventricular muscles and the central ganglionic neurons.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P35905-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002938_AF2.pdbhor002938_ESM.pdb

Physical Information

Mass: 72624 Formula: C32H42N6O9
Absent amino acids: ACDGHIKLMPQRSTWY Common amino acids: F
pI: 3.85 Basic residues: 0
Polar residues: 1 Hydrophobic residues: 3
Hydrophobicity: 56 Boman Index: -345
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 58
Instability Index: 800 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  9145419
  • Title:  A Novel D-amino Acid-Containing Peptide, Fulyal, Coexists With Fulicin Gene-Related Peptides in Achatina Atria.
  • PubMed ID:  1859408
  • Title:  Fulicin, a novel neuropeptide containing a D-amino acid residue isolated from the ganglia of Achatina fulica.