General Information

  • ID:  hor002906
  • Uniprot ID:  Q9VQ66
  • Protein name:  Neuropeptide-like peptide 4
  • Gene name:  Nplp4
  • Organism:  Drosophila melanogaster (Fruit fly)
  • Family:  NA
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  melanogaster subgroup, melanogaster group, Sophophora (subgenus), Drosophila (genus), Drosophilini (tribe), Drosophilinae (subfamily), Drosophilidae (family), Ephydroidea (superfamily), Acalyptratae, Schizophora, Cyclorrhapha, Eremoneura, Muscomorpha (infraorder), Brachycera (suborder), Diptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  QYYYGASPYAYSGGYYDSPYSY
  • Length:  22(41-62)
  • Propeptide:  MFKLLVVVFAALFAAALAVPAPVARANPAPIPIASPEPAPQYYYGASPYAYSGGYYDSPYSYYG
  • Signal peptide:  MFKLLVVVFAALFAAALA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9VQ66-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002906_AF2.pdbhor002906_ESM.pdb

Physical Information

Mass: 296040 Formula: C124H149N23O39
Absent amino acids: CEFHIKLMNRTVW Common amino acids: Y
pI: 3.75 Basic residues: 0
Polar residues: 16 Hydrophobic residues: 2
Hydrophobicity: -103.18 Boman Index: -2268
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 9.09
Instability Index: 8720.45 Extinction Coefficient cystines: 13410
Absorbance 280nm: 638.57

Literature

  • PubMed ID:  12171930
  • Title:  Peptidomics of the Larval Drosophila Melanogaster Central Nervous System.
  • PubMed ID:  14690519
  • Title:  Expression of a novel neuropeptide, NVGTLARDFQLPIPNamide, in the larval and adult brain of Drosophila melanogaster.