General Information

  • ID:  hor002905
  • Uniprot ID:  Q9VV28
  • Protein name:  VVI-amide peptide
  • Gene name:  Nplp3
  • Organism:  Drosophila melanogaster (Fruit fly)
  • Family:  NA
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  melanogaster subgroup, melanogaster group, Sophophora (subgenus), Drosophila (genus), Drosophilini (tribe), Drosophilinae (subfamily), Drosophilidae (family), Ephydroidea (superfamily), Acalyptratae, Schizophora, Cyclorrhapha, Eremoneura, Muscomorpha (infraorder), Brachycera (suborder), Diptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  SVHGLGPVVI
  • Length:  10(80-89)
  • Propeptide:  MFKLCVFVALLSLAAAAPAPAPAPAPAPGLIGPGIVAPGIWGPTVVGSPLLAPQVVSVVPGAISHAAITQVHPSPLLIKSVHGLGPVVIG
  • Signal peptide:  MFKLCVFVALLSLAAA
  • Modification:  T10 Isoleucine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q07892-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-Q07892-F1.pdbhor002905_AF2.pdbhor002905_ESM.pdb

Physical Information

Mass: 113789 Formula: C45H76N12O12
Absent amino acids: ACDEFKMNQRTWY Common amino acids: V
pI: 7.55 Basic residues: 1
Polar residues: 3 Hydrophobic residues: 5
Hydrophobicity: 145 Boman Index: 1578
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 165
Instability Index: 1789 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  12171930
  • Title:  Peptidomics of the Larval Drosophila Melanogaster Central Nervous System.
  • PubMed ID:  14690519
  • Title:  Expression of a novel neuropeptide, NVGTLARDFQLPIPNamide, in the larval and adult brain of Drosophila melanogaster.