General Information

  • ID:  hor002886
  • Uniprot ID:  P17219
  • Protein name:  P2K
  • Gene name:  NA
  • Organism:  Bombyx mori (Silk moth)
  • Family:  NA
  • Source:  Animal
  • Expression:  PTTH is synthesized by two dorsolateral neurosecretory cells of the Bombyx brain.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Bombyx (genus), Bombycinae (subfamily), Bombycidae (family), Bombycoidea (superfamily), Obtectomera, Ditrysia, Heteroneura (parvorder), Neolepidoptera (infraorder), Glossata (suborder), Lepidoptera (order), Amphiesmenoptera (superorder), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  NA

Sequence Information

  • Sequence:  PDVGGFMVEDQRTHKSHNYMM
  • Length:  21(33-53)
  • Propeptide:  MITRPIILVILCYAILMIVQSFVPKAVALKRKPDVGGFMVEDQRTHKSHNYMMKRARNDVLGDKENVRPNPYYTEPFDPDTSPEELSALIVDYANMIRNDVILLDNSVETRTRKRGNIQVENQAIPDPPCTCKYKKEIEDLGENSVPRFIETRNCNKTQQPTCRPPYICKESLYSITILKRRETKSQESLEIPNELKYRWVAESHPVSVACLCTRDYQLRYNNN
  • Signal peptide:  MITRPIILVILCYAILMIVQSFVPKAVAL
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  PTTH is a brain secretory polypeptide of insects which stimulates the prothoracic glands to produce and release ecdysone, the steroid essential to insect development.; Peptides P2K and P6K are presumed to be cleaved post-translationally and may play some
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P17219-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002886_AF2.pdbhor002886_ESM.pdb

Physical Information

Mass: 283670 Formula: C105H159N31O33S3
Absent amino acids: ACILW Common amino acids: M
pI: 6.5 Basic residues: 4
Polar residues: 6 Hydrophobic residues: 3
Hydrophobicity: -98.1 Boman Index: -5234
Half-Life / Aliphatic Index: >20 hour Aliphatic Index: 27.62
Instability Index: 5904.29 Extinction Coefficient cystines: 1490
Absorbance 280nm: 74.5

Literature

  • PubMed ID:  NA
  • Title:  NA