General Information

  • ID:  hor002855
  • Uniprot ID:  Q8ISH7
  • Protein name:  Feeding circuit activating peptide b
  • Gene name:  NA
  • Organism:  Aplysia californica (California sea hare)
  • Family:  NA
  • Source:  Animal
  • Expression:  Expressed in pleural, pedal, abdominal, buccal and cerebral ganglia.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Aplysia (genus), Aplysiidae (family), Aplysioidea (superfamily), Aplysiida (order), Tectipleura, Euthyneura, Heterobranchia (subclass), Gastropoda (class), Mollusca (phylum), Lophotrochozoa, Spiralia, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  ALDSLGGFQVHGW
  • Length:  13(134-146)
  • Propeptide:  MTFAASFRALLCVLFCAALVHCKTRTKRYVPHSELWRILAVVDELQREQAAEQRQEDALALALRSDIAGGGGGGQLADNVRWFPETYDYGALADRDVDKRVFDSLGGYEVHGFKKRGSLDAIPQDTDASSDKRALDSLGGFQVHGWKRALDTLGGFQVHGWKRGSGAEKRQVDRLGGFQVHGWKKRALDSLGGFQVHGWKKRGTGGQMHASSPRVVPWGSRSLLADTQSGHRWKRDTELVENRQTTGQQTEVNKR
  • Signal peptide:  MTFAASFRALLCVLFCAALVHC
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  May be important and unique components of intercellular signaling in the feeding circuitry and may contribute to the induction and persistence of food-induced arousal
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q8ISH7-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002855_AF2.pdbhor002855_ESM.pdb

Physical Information

Mass: 160077 Formula: C64H91N17O18
Absent amino acids: CEIKMNPRTY Common amino acids: G
pI: 5.29 Basic residues: 1
Polar residues: 4 Hydrophobic residues: 6
Hydrophobicity: 25.38 Boman Index: 150
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 90
Instability Index: 2925.38 Extinction Coefficient cystines: 5500
Absorbance 280nm: 458.33

Literature

  • PubMed ID:  12196603
  • Title:  Identification and characterization of the feeding circuit-activating peptides, a novel neuropeptide family of Aplysia.