General Information

  • ID:  hor002836
  • Uniprot ID:  Q95P23
  • Protein name:  ENc
  • Gene name:  ENPP
  • Organism:  Aplysia californica (California sea hare)
  • Family:  NA
  • Source:  Animal
  • Expression:  High expression in gut and CNS.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Aplysia (genus), Aplysiidae (family), Aplysioidea (superfamily), Aplysiida (order), Tectipleura, Euthyneura, Heterobranchia (subclass), Gastropoda (class), Mollusca (phylum), Lophotrochozoa, Spiralia, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  RLPSYGHSFL
  • Length:  10(181-190)
  • Propeptide:  MAKHDVTVMTLLLVVCALHVFDAQGTDVKLNDGFLRSGIMNIPFQRRVSPKYGHNFVGKRSGFQSPVSPSDYFIPDELNDEDESPNMDTYALFRELLGEYPSSELSDDDVIRPYPVVPWAWDRFENKRFSKENEKRGSPGFSHSFVGKRMDLSALEKELIAKLKAADLLSPLETEAPGKRRLPSYGHSFLGKRMPVDVFPRAIPSYSHNFVGKRSGNGENYFDDLDTFGDISQRADLGFTHSFVGKRGNTDFSRN
  • Signal peptide:  MAKHDVTVMTLLLVVCALHVFDAQG
  • Modification:  T10 Leucine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Enterins inhibited contractions of the gut. In the CNS, the cerebral and buccal ganglia, which control feeding, contained the enterins; Enterins reduced the firing of interneurons B4/5 during feeding motor programs which corresponded to a switch from eges
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q95P23-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002836_AF2.pdbhor002836_ESM.pdb

Physical Information

Mass: 133704 Formula: C55H81N15O14
Absent amino acids: ACDEIKMNQTVW Common amino acids: LS
pI: 9.35 Basic residues: 2
Polar residues: 4 Hydrophobic residues: 3
Hydrophobicity: -22 Boman Index: -1276
Half-Life: 1 hour Half-Life Yeast: 2 min
Half-Life E.Coli: 2 min Aliphatic Index 78
Instability Index: 3903 Extinction Coefficient cystines: 1490
Absorbance 280nm: 165.56

Literature

  • PubMed ID:  11588196
  • Title:  The Enterins: A Novel Family of Neuropeptides Isolated From the Enteric Nervous System and CNS of Aplysia