General Information

  • ID:  hor002825
  • Uniprot ID:  Q8T0Y7
  • Protein name:  CP2-derived peptide 2
  • Gene name:  CP2PP
  • Organism:  Aplysia californica (California sea hare)
  • Family:  NA
  • Source:  Animal
  • Expression:  Neurons.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Aplysia (genus), Aplysiidae (family), Aplysioidea (superfamily), Aplysiida (order), Tectipleura, Euthyneura, Heterobranchia (subclass), Gastropoda (class), Mollusca (phylum), Lophotrochozoa, Spiralia, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  MPFDL
  • Length:  5(27-31)
  • Propeptide:  MDSRICTSFARLMASALCVSTLLVTAMPFDLRRGSSDTDLDLQGHVDLGLDDLDKLRLIFPPGLIEEAFSQAQGKVDMPLPRQRTSSRSSERWAPKSKRFDFGFAGLDTYDAIHRALEQPARGTSNSGSGYNMLMKMQRHG
  • Signal peptide:  MDSRICTSFARLMASALCVSTLLVTA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Mediates intrinsic neuromodulation
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q8T0Y7-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002825_AF2.pdbhor002825_ESM.pdb

Physical Information

Mass: 69328 Formula: C29H43N5O8S
Absent amino acids: ACEGHIKNQRSTVWY Common amino acids: DFLMP
pI: 3.75 Basic residues: 0
Polar residues: 0 Hydrophobic residues: 2
Hydrophobicity: 68 Boman Index: 153
Half-Life / Aliphatic Index: 30 hour Aliphatic Index: 78
Instability Index: 15908 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  11786187
  • Title:  Cloning, Expression and Processing of the CP2 Neuropeptide Precursor of Aplysia