General Information

  • ID:  hor002798
  • Uniprot ID:  P12285
  • Protein name:  R15 alpha-1 peptide
  • Gene name:  NA
  • Organism:  Aplysia californica (California sea hare)
  • Family:  NA
  • Source:  Animal
  • Expression:  Expressed within the abdominal ganglion in neurons R15, RB(HE), the two L9(G) gill motoneurons, and L40 interneuron, all are parts of autonomic control circuit that contributes to implementing a central command to coordinate autonomic activity with escape
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Aplysia (genus), Aplysiidae (family), Aplysioidea (superfamily), Aplysiida (order), Tectipleura, Euthyneura, Heterobranchia (subclass), Gastropoda (class), Mollusca (phylum), Lophotrochozoa, Spiralia, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  DVSDGSAERRPYTRMGSGGLKLHCQVHPANCPGGLMVT
  • Length:  38(51-88)
  • Propeptide:  MDSAGLHINFRLSHVLTVVTCILYILPPTTTAYSLPAPGKAAFQHQLSKRDVSDGSAERRPYTRMGSGGLKLHCQVHPANCPGGLMVTKKSDLLGALLSRNSPSSYGLPSRDMSTAYKRQDVRQQLRMFDDLVQLRKLIETPSVYPSEEDEARLYD
  • Signal peptide:  MDSAGLHINFRLSHVLTVVTCILYIL
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  acts as an osmoregulatory peptide, increasing blood volume, and also modulates the activity of a set of cardiac motor neurons that control heart rate
  • Mechanism:  Isoform R15-1 produces peptide R15 alpha-2 which is a 24 aa long spliced form of peptide R15 alpha-1 which is produced by isoform R15-2.
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  24-31
  • Structure ID:  AF-P12285-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002798_AF2.pdbhor002798_ESM.pdb

Physical Information

Mass: 465869 Formula: C166H270N54O53S4
Absent amino acids: FIW Common amino acids: G
pI: 8.24 Basic residues: 6
Polar residues: 15 Hydrophobic residues: 8
Hydrophobicity: -45.26 Boman Index: -6814
Half-Life / Aliphatic Index: 1.1 hour Aliphatic Index: 58.95
Instability Index: 3208.95 Extinction Coefficient cystines: 1615
Absorbance 280nm: 43.65

Literature

  • PubMed ID:  17228083
  • Title:  Autonomic Control Network Active in Aplysia During Locomotion Includes Neurons That Express Splice Variants of R15-neuropeptides