General Information

  • ID:  hor002791
  • Uniprot ID:  P01364
  • Protein name:  Histidine-rich basic peptide
  • Gene name:  NA
  • Organism:  Aplysia californica (California sea hare)
  • Family:  NA
  • Source:  Animal
  • Expression:  Neurons R3-R14. A cluster of 12 giant neurons located on the right side of the abdominal ganglion.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Aplysia (genus), Aplysiidae (family), Aplysioidea (superfamily), Aplysiida (order), Tectipleura, Euthyneura, Heterobranchia (subclass), Gastropoda (class), Mollusca (phylum), Lophotrochozoa, Spiralia, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  QVAQMHVWRAVNHDRNHGTGSGRHGRFLIRNRYRYGGGHLSDA
  • Length:  43(66-108)
  • Propeptide:  MQVLHLCLAVSIAVALLSQAAWSEEVFDDTDVGDELTNALESVLTDFKDKREAEEPSAFMTRLRRQVAQMHVWRAVNHDRNHGTGSGRHGRFLIRNRYRYGGGHLSDA
  • Signal peptide:  MQVLHLCLAVSIAVALLSQAAWS
  • Modification:  T1 Pyrrolidone carboxylic acid
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  HRBP is a myoactive peptide that excites Aplysia heart and enhances gut motility in vitro.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P01364-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002791_AF2.pdbhor002791_ESM.pdb

Physical Information

Mass: 569079 Formula: C211H324N80O58S
Absent amino acids: CEKP Common amino acids: GR
pI: 12.11 Basic residues: 12
Polar residues: 15 Hydrophobic residues: 11
Hydrophobicity: -106.51 Boman Index: -13928
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 54.42
Instability Index: 1735.35 Extinction Coefficient cystines: 8480
Absorbance 280nm: 201.9

Literature

  • PubMed ID:  2573895
  • Title:  Aplysia californica neurons R3-R14: primary structure of the myoactive histidine-rich basic peptide and peptide I.
  • PubMed ID:  3549995
  • Title:  Proteolytic Processing of the Aplysia Egg-Laying Hormone and R3-14 Neuropeptide Precursors