General Information

  • ID:  hor002766
  • Uniprot ID:  A0A0L0CC22
  • Protein name:  MGYa
  • Gene name:  NA
  • Organism:  Lucilia cuprina (Green bottle fly) (Australian sheep blowfly)
  • Family:  NA
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Lucilia (genus), Luciliinae (subfamily), Calliphoridae (family), Oestroidea (superfamily), Calyptratae, Schizophora, Cyclorrhapha, Eremoneura, Muscomorpha (infraorder), Brachycera (suborder), Diptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  NA

Sequence Information

  • Sequence:  YVGALARSGGLMGY
  • Length:  14(158-171)
  • Propeptide:  MPPVNNNNKKNLHPLAVIKLCVLFGMLLNVLQHPRAVKATDDVANVSPCELESIINQLVYPSPQYQMHAASLRNQLRNILRERQLEEGEEQSLNNDMDYLEEDKRSVAALAAQGLLHHNNNAAAAKRSLATLAKNGQLPTPDPEIMPDGDQRSEDKRYVGALARSGGLMGYGKRNIGTLARDFQLPQNGKRNLATMARLGMLGNRNDPKRNLASVARYNSRMYNNAAEKRNIGALKGSPVHGGVQMKRSEDDVYL
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-A0A0L0CC22-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002766_AF2.pdbhor002766_ESM.pdb

Physical Information

Mass: 164671 Formula: C63H99N17O18S
Absent amino acids: CDEFHIKNPQTW Common amino acids: G
pI: 9.17 Basic residues: 1
Polar residues: 7 Hydrophobic residues: 5
Hydrophobicity: 55.71 Boman Index: 501
Half-Life / Aliphatic Index: 2.8 hour Aliphatic Index: 90.71
Instability Index: 3129.29 Extinction Coefficient cystines: 2980
Absorbance 280nm: 229.23

Literature

  • PubMed ID:  23280433
  • Title:  Neuropeptidomics of the Australian Sheep Blowfly Lucilia Cuprina (Wiedemann) and Related Diptera