General Information

  • ID:  hor002756
  • Uniprot ID:  A0A8J5JJ87
  • Protein name:  NA
  • Gene name:  H2A-L7
  • Organism:  Homarus americanus (American lobster)
  • Family:  Histone H2A family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Homarus (genus), Nephropidae (family), Nephropoidea (superfamily), Astacidea (infraorder), Pleocyemata (suborder), Decapoda (order), Eucarida (superorder), Eumalacostraca (subclass), Malacostraca (class), Multicrustacea (superclass), Crustacea (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0003677 DNA binding; GO:0030527 structural constituent of chromatin; GO:0046982 protein heterodimerization activity
  • GO BP:  NA
  • GO CC:  GO:0000786 nucleosome; GO:0005634 nucleus; GO:0005694 chromosome

Sequence Information

  • Sequence:  AVLLPKKTEKK
  • Length:  11
  • Propeptide:  MSGRGKGGKVKGKSKSRSSRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTEKK
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002756_AF2.pdbhor002756_ESM.pdb

Physical Information

Mass: 143313 Formula: C58H107N15O15
Absent amino acids: CDFGHIMNQRSWY Common amino acids: K
pI: 10.8 Basic residues: 4
Polar residues: 1 Hydrophobic residues: 4
Hydrophobicity: -70.91 Boman Index: -1589
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 106.36
Instability Index: 4410.91 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  18304551
  • Title:  Mass Spectral Characterization of Peptide Transmitters/Hormones in the Nervous System and Neuroendocrine Organs of the American Lobster Homarus Americanus