General Information

  • ID:  hor002755
  • Uniprot ID:  A0A8J5JRZ8
  • Protein name:  CCAP precursor-related peptides
  • Gene name:  Ccap-L
  • Organism:  Homarus americanus (American lobster)
  • Family:  NA
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Homarus (genus), Nephropidae (family), Nephropoidea (superfamily), Astacidea (infraorder), Pleocyemata (suborder), Decapoda (order), Eucarida (superorder), Eumalacostraca (subclass), Malacostraca (class), Multicrustacea (superclass), Crustacea (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  NA

Sequence Information

  • Sequence:  DIGDLLEGKD
  • Length:  10(37-46)
  • Propeptide:  MTNMSWCGRVGILGVTTVLLLVLLAAHAQAGPVAKRDIGDLLEGKDKRPFCNAFTGCGKKRSDPSMEGLASSSELDALAKHMEMMRSYASRMENHPVYRRKRSTPHTQPRQHLTSTPQQKVETEKQ
  • Signal peptide:  MTNMSWCGRVGILGVTTVLLLVLLAAHAQA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002755_AF2.pdbhor002755_ESM.pdb

Physical Information

Mass: 123489 Formula: C45H75N11O19
Absent amino acids: ACFHMNPQRSTVWY Common amino acids: D
pI: 3.7 Basic residues: 1
Polar residues: 2 Hydrophobic residues: 3
Hydrophobicity: -66 Boman Index: -2188
Half-Life / Aliphatic Index: 1.1 hour Aliphatic Index: 117
Instability Index: 51 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  18304551
  • Title:  Mass Spectral Characterization of Peptide Transmitters/Hormones in the Nervous System and Neuroendocrine Organs of the American Lobster Homarus Americanus