General Information

  • ID:  hor002748
  • Uniprot ID:  Q9W0W6
  • Protein name:  APK peptide
  • Gene name:  Nplp1
  • Organism:  Drosophila melanogaster (Fruit fly)
  • Family:  NA
  • Source:  Animal
  • Expression:  MTYamide peptide: Expressed in the larval CNS (at protein level). NAP peptide: Expressed in the larval CNS (at protein level). IPNamide peptide: Expressed in the ventral ganglion of the third larval instar and adult brain (at protein level).
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  melanogaster subgroup, melanogaster group, Sophophora (subgenus), Drosophila (genus), Drosophilini (tribe), Drosophilinae (subfamily), Drosophilidae (family), Ephydroidea (superfamily), Acalyptratae, Schizophora, Cyclorrhapha, Eremoneura, Muscomorpha (infraorder), Brachycera (suborder), Diptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005184 neuropeptide hormone activity; GO:0048018 receptor ligand activity
  • GO BP:  GO:0007168 receptor guanylyl cyclase signaling pathway; GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  SVAALAAQGLLNAPK
  • Length:  15(102-116)
  • Propeptide:  MQAVLQSAHSSRRLMLLLSMLLNAAIQPRSIIVSATDDVANVSPCEMESLINQLMSPSPEYQLHASALRNQLKNLLRERQLAVGEEQPLGEYPDYLEEDKRSVAALAAQGLLNAPKRSLATLAKNGQLPTAEPGEDYGDADSGEPSEQKRYIGSLARAGGLMTYGKRNVGTLARDFQLPIPNGKRNIATMARLQSAPSTHRDPKRNVAAVARYNSQHGHIQRAGAEKRNLGALKSSPVHGVQQKREDEEMLLPAA
  • Signal peptide:  MQAVLQSAHSSRRLMLLLSMLLNAAIQP
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  [NPLP1-4]: Acts as a ligand for the receptor-type guanylate cyclase Gyc76C (PubMed:21893139). Stimulates Gyc76c-dependent cGMP production and modulates the IMD innate immune pathway in response to salt stress by inducing nuclear translocation of NF-kappa-
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9W0W6-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor002748_AF2.pdbhor002748_ESM.pdb

Physical Information

Mass: 167360 Formula: C63H110N18O19
Absent amino acids: CDEFHIMRTWY Common amino acids: A
pI: 9.7 Basic residues: 1
Polar residues: 3 Hydrophobic residues: 9
Hydrophobicity: 72.67 Boman Index: 766
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 130.67
Instability Index: 2217.33 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  20575072
  • Title:  Multiple neuropeptides in the Drosophila antennal lobe suggest complex modulatory circuits.