General Information

  • ID:  hor002739
  • Uniprot ID:  A0A8C2UGV8
  • Protein name:  ODN peptide
  • Gene name:  DBI
  • Organism:  Coturnix japonica (Japanese quail) (Coturnix coturnix japonica)
  • Family:  NA
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Coturnix (genus), Perdicinae (subfamily), Phasianidae (family), Galliformes (order), Galloanserae (superorder), Neognathae (infraclass), Aves (class), Coelurosauria, Theropoda, Saurischia, Dinosauria, Archosauria, Archelosauria, Sauria, Sauropsida, Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0000062 fatty-acyl-CoA binding; GO:0008289 lipid binding
  • GO BP:  NA
  • GO CC:  GO:0005783 endoplasmic reticulum; GO:0005794 Golgi apparatus

Sequence Information

  • Sequence:  TVGDVNTDRPGMLDF
  • Length:  15(36-50)
  • Propeptide:  MSEAAFQKAAEEVKQLKSQPTDQEMLDVYSHYKQATVGDVNTDRPGMLDFKGKAKWDAWNALKGMSKEDAMKAYIAKVEELKGKYGI
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002739_AF2.pdbhor002739_ESM.pdb

Physical Information

Mass: 188670 Formula: C69H109N19O25S
Absent amino acids: ACEHIKQSWY Common amino acids: D
pI: 3.83 Basic residues: 1
Polar residues: 5 Hydrophobic residues: 4
Hydrophobicity: -36 Boman Index: -3265
Half-Life / Aliphatic Index: 7.2 hour Aliphatic Index: 64.67
Instability Index: 80 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  20298575
  • Title:  Neuropeptidomic Analysis of the Embryonic Japanese Quail Diencephalon