General Information

  • ID:  hor002720
  • Uniprot ID:  F5XVF1
  • Protein name:  Ci-LF-5
  • Gene name:  ci-lf
  • Organism:  Ciona intestinalis (Transparent sea squirt) (Ascidia intestinalis)
  • Family:  NA
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Ciona (genus), Cionidae (family), Phlebobranchia (order), Ascidiacea (class), Tunicata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  NA

Sequence Information

  • Sequence:  SPGMLGLF
  • Length:  8(162-169)
  • Propeptide:  MKLVKSFSILAAFVVCYFGCIADAVPVDTVEKQLLRREGTGNPENFLDWTNQLNSTDVDEPDEELYDQLLYNILIPMQQKMIAEENGQLDNAEDNPFLAENRNSDEENNDYSPGQAESIQSDKRFQSLFKRYPGFQGLFKRHNPHLPDLFKRYNSMGLFKRSPGMLGLFKRGLLGLFKRSDARLQGLFKRDSATQGSFKRSSEAQALPKRYPNFQGLFKRLSEATEYPEDDSSNDDTKQRGNLHSLFKRDTSAHY
  • Signal peptide:  MKLVKSFSILAAFVVCYFGCIADA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  The sequence shown here is derived from an EMBL/GenBank/DDBJ third party annotation (TPA) entry.
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-F5XVF1-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002720_AF2.pdbhor002720_ESM.pdb

Physical Information

Mass: 94604 Formula: C38H60N8O10S
Absent amino acids: ACDEHIKNQRTVWY Common amino acids: GL
pI: 6.11 Basic residues: 0
Polar residues: 3 Hydrophobic residues: 3
Hydrophobicity: 113.75 Boman Index: 1365
Half-Life / Aliphatic Index: 1.9 hour Aliphatic Index: 97.5
Instability Index: 6367.5 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  21467196
  • Title:  Peptidomic Analysis of the Central Nervous System of the Protochordate, Ciona Intestinalis: Homologs and Prototypes of Vertebrate Peptides and Novel Peptides