General Information

  • ID:  hor002648
  • Uniprot ID:  Q8MQ06
  • Protein name:  NLP-19
  • Gene name:  nlp-19
  • Organism:  Caenorhabditis elegans
  • Family:  NA
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Caenorhabditis (genus), Peloderinae (subfamily), Rhabditidae (family), Rhabditoidea (superfamily), Rhabditomorpha (infraorder), Rhabditina (suborder), Rhabditida (order), Chromadorea (class), Nematoda (phylum), Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  NA

Sequence Information

  • Sequence:  IGLRLPNML
  • Length:  9(55-63)
  • Propeptide:  MLLRGVCLALLILVTIVQCQNDNDLKEEKRRIGLRLPNFLRFKDPDALMIHKRRIGLRLPNMLKFKDSSNMYHLEKRRMGMRLPNIIFLRNEKKNVLEY
  • Signal peptide:  MLLRGVCLALLILVTIVQC
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q8MQ06-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002648_AF2.pdbhor002648_ESM.pdb

Physical Information

Mass: 116919 Formula: C46H83N13O11S
Absent amino acids: ACDEFHKQSTVWY Common amino acids: L
pI: 10.55 Basic residues: 1
Polar residues: 2 Hydrophobic residues: 4
Hydrophobicity: 86.67 Boman Index: 141
Half-Life / Aliphatic Index: 20 hour Aliphatic Index: 173.33
Instability Index: 5168.89 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  20013198
  • Title:  Approaches to Identify Endogenous Peptides in the Soil Nematode Caenorhabditis elegans