General Information

  • ID:  hor002629
  • Uniprot ID:  O44540
  • Protein name:  NLP-13
  • Gene name:  nlp-13
  • Organism:  Caenorhabditis elegans
  • Family:  NA
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Caenorhabditis (genus), Peloderinae (subfamily), Rhabditidae (family), Rhabditoidea (superfamily), Rhabditomorpha (infraorder), Rhabditina (suborder), Rhabditida (order), Chromadorea (class), Nematoda (phylum), Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  SSSMYDRDIMSF
  • Length:  12(93-104)
  • Propeptide:  MQRSLQIFCIMSAIAMAYSQGSRDDNQSAKRNDFSRDIMSFGKRSGNTADLYDRRIMAFGKRQPSYDRDIMSFGKRSAPSDFSRDIMSFGKRSSSMYDRDIMSFGKRSPVDYDRPIMAFGKRAEDYERQIMAFGRRK
  • Signal peptide:  MQRSLQIFCIMSAIAMAYS
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-O44540-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002629_AF2.pdbhor002629_ESM.pdb

Physical Information

Mass: 163496 Formula: C60H91N15O22S2
Absent amino acids: ACEGHKLNPQTVW Common amino acids: S
pI: 4.11 Basic residues: 1
Polar residues: 5 Hydrophobic residues: 2
Hydrophobicity: -40.83 Boman Index: -3350
Half-Life / Aliphatic Index: 1.9 hour Aliphatic Index: 32.5
Instability Index: 11106.67 Extinction Coefficient cystines: 1490
Absorbance 280nm: 135.45

Literature

  • PubMed ID:  20013198
  • Title:  Approaches to Identify Endogenous Peptides in the Soil Nematode Caenorhabditis elegans