General Information

  • ID:  hor002621
  • Uniprot ID:  O01970
  • Protein name:  NLP-12
  • Gene name:  nlp-12
  • Organism:  Caenorhabditis elegans
  • Family:  NA
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Caenorhabditis (genus), Peloderinae (subfamily), Rhabditidae (family), Rhabditoidea (superfamily), Rhabditomorpha (infraorder), Rhabditina (suborder), Rhabditida (order), Chromadorea (class), Nematoda (phylum), Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0031739 cholecystokinin receptor binding
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0060756 foraging behavior
  • GO CC:  GO:0005615 extracellular space; GO:0043005 neuron projection; GO:0043025 neuronal cell body

Sequence Information

  • Sequence:  DYRPLQF
  • Length:  7(33-39)
  • Propeptide:  MLRHHSCALLMLILVFVEVFATQSPTFDRQDRDYRPLQFGKRDGYRPLQFGKRDYRPLQFGKRSSGSSGPVVLEPIWEWQ
  • Signal peptide:  MLRHHSCALLMLILVFVEVFA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-O01970-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002621_AF2.pdbhor002621_ESM.pdb

Physical Information

Mass: 104525 Formula: C44H63N11O12
Absent amino acids: ACEGHIKMNSTVW Common amino acids: DFLPQRY
pI: 6.34 Basic residues: 1
Polar residues: 1 Hydrophobic residues: 2
Hydrophobicity: -111.43 Boman Index: -2142
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 55.71
Instability Index: 4772.86 Extinction Coefficient cystines: 1490
Absorbance 280nm: 248.33

Literature

  • PubMed ID:  20013198
  • Title:  Approaches to Identify Endogenous Peptides in the Soil Nematode Caenorhabditis elegans