General Information

  • ID:  hor002612
  • Uniprot ID:  Q20114
  • Protein name:  NLP-10
  • Gene name:  nlp-10
  • Organism:  Caenorhabditis elegans
  • Family:  NA
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Caenorhabditis (genus), Peloderinae (subfamily), Rhabditidae (family), Rhabditoidea (superfamily), Rhabditomorpha (infraorder), Rhabditina (suborder), Rhabditida (order), Chromadorea (class), Nematoda (phylum), Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  NA

Sequence Information

  • Sequence:  SGQIFAQ
  • Length:  7(82-88)
  • Propeptide:  MWYIALLLAVIATSVTAQKADDEPIVFLVRVPIDEMDDDSSLLESYYHPRDILSKRAIPFNGGMYGKRSTMPFSGGMYGKRSGQIFAQRRAAIPFSGGMYGKRSLVPQSYSNNENQIKRGAMPFSGGMYGR
  • Signal peptide:  MWYIALLLAVIATSVTA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q20114-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor002612_AF2.pdbhor002612_ESM.pdb

Physical Information

Mass: 85703 Formula: C33H51N9O11
Absent amino acids: CDEHKLMNPRTVWY Common amino acids: Q
pI: 6.11 Basic residues: 0
Polar residues: 2 Hydrophobic residues: 3
Hydrophobicity: 12.86 Boman Index: -383
Half-Life / Aliphatic Index: 1.9 hour Aliphatic Index: 70
Instability Index: 857.14 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  17564681
  • Title:  Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry.