General Information

  • ID:  hor002609
  • Uniprot ID:  Q11088
  • Protein name:  NLP-1
  • Gene name:  nlp-1
  • Organism:  Caenorhabditis elegans
  • Family:  NA
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Caenorhabditis (genus), Peloderinae (subfamily), Rhabditidae (family), Rhabditoidea (superfamily), Rhabditomorpha (infraorder), Rhabditina (suborder), Rhabditida (order), Chromadorea (class), Nematoda (phylum), Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0001966 thigmotaxis; GO:0071244 cellular response to carbon dioxide; GO:1903745 negative regulation of nematode pharyngeal pumping
  • GO CC:  NA

Sequence Information

  • Sequence:  VNLDPNSFRMSF
  • Length:  12(143-154)
  • Propeptide:  MKATFVLACLLVIAAVSHADLLPKRMDANAFRMSFGKRSVSNPAEAKRMDPNAFRMSFGKRSAEQNEQANKEDKATSDKLYDDTKFEEMKRMDANAFRMSFGKRSDAHQAADDQVEYVNDDFSLPEQKRMDANAFRMSFGKRVNLDPNSFRMSFGKRSTVGYNLDARNYFVGLGRR
  • Signal peptide:  MKATFVLACLLVIAAVSHA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  In AWC olfactory sensory neurons, required for the detection of preferred food sources.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q11088-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002609_AF2.pdbhor002609_ESM.pdb

Physical Information

Mass: 162298 Formula: C63H95N17O19S
Absent amino acids: ACEGHIKQTWY Common amino acids: FNS
pI: 6.34 Basic residues: 1
Polar residues: 4 Hydrophobic residues: 4
Hydrophobicity: -22.5 Boman Index: -2645
Half-Life / Aliphatic Index: 100 hour Aliphatic Index: 56.67
Instability Index: 4503.33 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  20013198
  • Title:  Approaches to Identify Endogenous Peptides in the Soil Nematode Caenorhabditis elegans