General Information

  • ID:  hor002608
  • Uniprot ID:  Q11088
  • Protein name:  NLP-1
  • Gene name:  nlp-1
  • Organism:  Caenorhabditis elegans
  • Family:  NA
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Caenorhabditis (genus), Peloderinae (subfamily), Rhabditidae (family), Rhabditoidea (superfamily), Rhabditomorpha (infraorder), Rhabditina (suborder), Rhabditida (order), Chromadorea (class), Nematoda (phylum), Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0001966 thigmotaxis; GO:0071244 cellular response to carbon dioxide; GO:1903745 negative regulation of nematode pharyngeal pumping
  • GO CC:  NA

Sequence Information

  • Sequence:  MDPNAFRMSF
  • Length:  10(49-58)
  • Propeptide:  MKATFVLACLLVIAAVSHADLLPKRMDANAFRMSFGKRSVSNPAEAKRMDPNAFRMSFGKRSAEQNEQANKEDKATSDKLYDDTKFEEMKRMDANAFRMSFGKRSDAHQAADDQVEYVNDDFSLPEQKRMDANAFRMSFGKRVNLDPNSFRMSFGKRSTVGYNLDARNYFVGLGRR
  • Signal peptide:  MKATFVLACLLVIAAVSHA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  In AWC olfactory sensory neurons, required for the detection of preferred food sources.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q11088-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002608_AF2.pdbhor002608_ESM.pdb

Physical Information

Mass: 137611 Formula: C53H78N14O15S2
Absent amino acids: CEGHIKLQTVWY Common amino acids: FM
pI: 6.34 Basic residues: 1
Polar residues: 2 Hydrophobic residues: 3
Hydrophobicity: -27 Boman Index: -2121
Half-Life / Aliphatic Index: 30 hour Aliphatic Index: 10
Instability Index: 5294 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  20013198
  • Title:  Approaches to Identify Endogenous Peptides in the Soil Nematode Caenorhabditis elegans