General Information

  • ID:  hor002554
  • Uniprot ID:  P35581
  • Protein name:  Apidaecin-1
  • Gene name:  NA
  • Organism:  Apis mellifera (Honeybee)
  • Family:  Apidaecin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Apis (genus), Apini (tribe), Apinae (subfamily), Apidae (family), Apoidea (superfamily), Aculeata (infraorder), Apocrita (suborder), Hymenoptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0002376 immune system process; GO:0042742 defense response to bacterium; GO:0045087 innate immune response
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  PVYIPQPRPP
  • Length:  10
  • Propeptide:  MKNFALAILVVTFVVAVFGNTNLDPPTRPTRLRREAEPEAEPGNNRPVYIPQPRPPHPRLRREAEPEAEPGNNRPVYIPQPRPPHPRLRREAEPEAEPGNNRPVYIPQPRPPHPRLRREAEPEAEPGNNRPVYIPQPRPPHPRI
  • Signal peptide:  MKNFALAILVVTFVVAVFG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Apidaecins have bactericidal activity; predominantly against Gram-negative bacteria (PubMed:2676519, PubMed:7929322). They seem to interfere with cell propagation (PubMed:2676519).
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P35581-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor002554_AF2.pdbhor002554_ESM.pdb

Physical Information

Mass: 132408 Formula: C56H86N14O13
Absent amino acids: ACDEFGHKLMNSTW Common amino acids: P
pI: 9.35 Basic residues: 1
Polar residues: 1 Hydrophobic residues: 2
Hydrophobicity: -86 Boman Index: -1164
Half-Life: >20 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: ? Aliphatic Index 68
Instability Index: 8734 Extinction Coefficient cystines: 1490
Absorbance 280nm: 165.56

Literature

  • PubMed ID:  19576913
  • Title:  Mass Spectrometric Profiling of (Neuro)-Peptides in the Worker Honeybee, Apis Mellifera