General Information

  • ID:  hor002526
  • Uniprot ID:  A0A096MK47
  • Protein name:  Macrophage inhibitory factor
  • Gene name:  Mlip
  • Organism:  Rattus norvegicus (Rat)
  • Family:  NA
  • Source:  Animal
  • Expression:  Expressed in cardiomyoctes. Expression is highly reduced in hypertrophic cardiomyocytes.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Rattus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0003714 transcription corepressor activity; GO:0005521 lamin binding
  • GO BP:  GO:0000122 negative regulation of transcription by RNA polymerase II; GO:0006366 transcription by RNA polymerase II; GO:0010614 negative regulation of cardiac muscle hypertrophy; GO:0045892 negative regulation of DNA-templated transcription; GO:0045944 positive regulation of transcription by RNA polymerase II; GO:1903243 negative regulation of cardiac muscle hypertrophy in response to stress
  • GO CC:  GO:0005634 nucleus; GO:0005635 nuclear envelope; GO:0005737 cytoplasm; GO:0005829 cytosol; GO:0005886 plasma membrane; GO:0016020 membrane; GO:0016605 PML body; GO:0031981 nuclear lumen; GO:0042383 sarcolemma

Sequence Information

  • Sequence:  TKP
  • Length:  3(837-839)
  • Propeptide:  MEFEKHEQGNALKKNEKLEERVTFEYSDHMTFSCESKEERDQRILDYPSEVSGKNSQRKEFNTKEPQGMQKGDLFKAEYVFIVDSDGEDEATCRQGEQGPPGATGNIATRPKSLAISSSLASDVVRPKVRGVDVKVSSHPEIPHGIAPQQKHGQLTSPTTSEQLAHKPPAFSFVSPTNQKTPPVPAKVSGTTVLEEFHIRRLDVHGASEEETATYFHTTAHDSPLPAWKGASTLVFSPSAQLPGSSLCGSNVADH
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Required for precocious cardiac adaptation to stress through integrated regulation of the AKT/mTOR pathways and FOXO1. Regulates cardiac homeostasis and plays an important role in protection against cardiac hypertrophy (PubMed:22343712, PubMed:26436652).
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-A0A096MK47-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002526_AF2.pdbhor002526_ESM.pdb

Physical Information

Mass: 38026 Formula: C15H28N4O5
Absent amino acids: ACDEFGHILMNQRSVWY Common amino acids: KPT
pI: 9.7 Basic residues: 1
Polar residues: 1 Hydrophobic residues: 0
Hydrophobicity: -206.67 Boman Index: -812
Half-Life / Aliphatic Index: 7.2 hour Aliphatic Index: 0
Instability Index: -1846.67 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  20873405
  • Title:  [Experimental Hemorrhagic Stroke: The Study of Neuropeptides (MIF, Selank) in the Intraperitoneal Injection]