General Information

  • ID:  hor002512
  • Uniprot ID:  Q9BT56
  • Protein name:  NPQ 53-70
  • Gene name:  SPX
  • Organism:  Homo sapiens (Human)
  • Family:  Spexin family
  • Source:  Human
  • Expression:  Down-regulated in omental and subcutaneous fat of obese subjects. |Expressed in the type I glomic cells within the carotid body (at protein level). Expressed predominantly in pancreas, testis, kidney, brain and placenta. Expressed in submucosal layer of e
  • Disease:  Diseases associated with SPX include Noonan Syndrome 9 and Acute Endophthalmitis.
  • Comments:  antinociceptive activity:10 nmol
  • Taxonomy:  Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity; GO:0005515 protein binding
  • GO BP:  GO:0003084 positive regulation of systemic arterial blood pressure; GO:0007165 signal transduction; GO:0010459 negative regulation of heart rate; GO:0032099 negative regulation of appetite; GO:0035814 negative regulation of renal sodium excretion; GO:0044539 long-chain fatty acid import into cell; GO:0051930 regulation of sensory perception of pain; GO:1904306 positive regulation of gastro-intestinal system smooth muscle contraction
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0005737 cytoplasm

Sequence Information

  • Sequence:  FISDQSRRKDLSDRPLPE
  • Length:  18
  • Propeptide:  MKGLRSLAATTLALFLVFVFLGNSSCAPQRLLERRNWTPQAMLYLKGAQGRRFISDQSRRKDLSDRPLPERRSPNPQLLTIPEAATILLASLQKSPEDEEKNFDQTRFLEDSLLNW
  • Signal peptide:  MKGLRSLAATTLALFLVFVFLGNSSC
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Contribute to CNS-mediated control of arterial blood pressure and salt and water balance and modulate nociceptive responses.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9BT56-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor002512_AF2.pdbhor002512_ESM.pdb

Physical Information

Mass: 246278 Formula: C92H151N29O31
Absent amino acids: ACGHMNTVWY Common amino acids: DRS
pI: 6.6 Basic residues: 4
Polar residues: 3 Hydrophobic residues: 4
Hydrophobicity: -142.22 Boman Index: -8128
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 65
Instability Index: 10324.44 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  22038051
  • Title:  Peptides Derived From the Prohormone proNPQ/spexin Are Potent Central Modulators of Cardiovascular and Renal Function and Nociception