General Information

  • ID:  hor002506
  • Uniprot ID:  Q16RI5
  • Protein name:  AKH/corazonin-related peptide
  • Gene name:  NA
  • Organism:  Aedes aegypti (Yellowfever mosquito) (Culex aegypti)
  • Family:  AKH/HRTH/RPCH family
  • Source:  Animal
  • Expression:  Much more expressed in adults than in larvae. |Only expressed in the head and thorax body segments of adults. Is more expressed in adult males than in females.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Stegomyia (subgenus), Aedes (genus), Aedini (tribe), Culicinae (subfamily), Culicidae (family), Culicoidea (superfamily), Culicomorpha (infraorder), Nematocera (suborder), Diptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  QVTFSRDWNA
  • Length:  10(26-35)
  • Propeptide:  MRNSIYKLIMFAVLCMVLTSSLSYAQVTFSRDWNAGKRSLAEAAQSTGDCAAIWRSVTNLCAAVTKNIQHLTMCEARALMKNLQSEDASMENNGGGGLPLFSNGHL
  • Signal peptide:  MRNSIYKLIMFAVLCMVLTSSLSYA
  • Modification:  T1 Pyrrolidone carboxylic acid;T10 Alanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Neuropeptide with neuromodulator or neurotransmitter role that activates the adipokinetic hormone/corazonin-related peptide receptor (ACPR) (Probable). May function in regulation of post-ecdysis activities (Probable). Does not activate the A.gambiae adipo
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q16RI5-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002506_AF2.pdbhor002506_ESM.pdb

Physical Information

Mass: 138402 Formula: C54H78N16O17
Absent amino acids: CEGHIKLMPY Common amino acids: ADFNQRSTVW
pI: 6.34 Basic residues: 1
Polar residues: 3 Hydrophobic residues: 4
Hydrophobicity: -86 Boman Index: -3063
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 39
Instability Index: 3691 Extinction Coefficient cystines: 5500
Absorbance 280nm: 611.11

Literature

  • PubMed ID:  20068045
  • Title:  Discovery of a Novel Insect Neuropeptide Signaling System Closely Related to the Insect Adipokinetic Hormone and Corazonin Hormonal Systems