General Information

  • ID:  hor002478
  • Uniprot ID:  I7C2V3
  • Protein name:  Spexin
  • Gene name:  spx
  • Organism:  Carassius auratus (Goldfish)
  • Family:  Spexin family
  • Source:  animal
  • Expression:  Up-regulated during female seasonal sexual maturation and after ovariectomy. Up-regulated by food intake in brain areas involved in appetit control. |Expressed in the anterior hypothalamus, ventromedial thalamic nucleus and medial longitudinal fasciculus
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Carassius (genus), Cyprininae (subfamily), Cyprinidae (family), Cyprinoidei (suborder), Cypriniformes (order), Cypriniphysae (superorder), Otophysi, Ostariophysi (subcohort), Otomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity; GO:0031765 type 2 galanin receptor binding; GO:0031766 type 3 galanin receptor binding
  • GO BP:  GO:0003084 positive regulation of systemic arterial blood pressure; GO:0007165 signal transduction; GO:0010459 negative regulation of heart rate; GO:0032099 negative regulation of appetite; GO:0035814 negative regulation of renal sodium excretion; GO:0044539 long-chain fatty acid import into cell; GO:0045944 positive regulation of transcription by RNA polymerase II; GO:0051930 regulation of sensory perception of pain
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0030133 transport vesicle; GO:0031410 cytoplasmic vesicle

Sequence Information

  • Sequence:  NWTPQAMLYLKGT
  • Length:  13
  • Propeptide:  MKDLRTLAAYALALLLLATFVSYSRSAPMGSFQRRNWTPQAMLYLKGTQGRRFVSEDRNEGDLYDTIRLESQSQNTENLSISKAAAFLLNVLQQARDEGEPY
  • Signal peptide:  MKDLRTLAAYALALLLLATFVSYSRS
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Spexin is involved in the negative regulation of the reproductive axis.
  • Mechanism:  Amidated and nonamidated form of Spexin-1 had similar effects on food intake/feeding behaviors.
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-I7C2V3-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor002478_AF2.pdbhor002478_ESM.pdb

Physical Information

Mass: 173701 Formula: C70H107N17O19S
Absent amino acids: CDEFHIRSV Common amino acids: LT
pI: 9.3 Basic residues: 1
Polar residues: 5 Hydrophobic residues: 4
Hydrophobicity: -40 Boman Index: -574
Half-Life: 1.4 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 67.69
Instability Index: -1508.46 Extinction Coefficient cystines: 6990
Absorbance 280nm: 582.5

Literature

  • PubMed ID:  23623870
  • Title:  A Novel Neuropeptide in Suppressing Luteinizing Hormone Release in Goldfish, Carassius Auratus