General Information

  • ID:  hor002466
  • Uniprot ID:  Q10998
  • Protein name:  Cerebral peptide 1
  • Gene name:  NA
  • Organism:  Aplysia californica (California sea hare)
  • Family:  NA
  • Source:  Animal
  • Expression:  Cerebral peptide 1 is expressed in the cerebral, pedal and buccal ganglia and B1 and B2 neurons. APGW-amide is expressed in buccal ganglia and several neurons.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Aplysia (genus), Aplysiidae (family), Aplysioidea (superfamily), Aplysiida (order), Tectipleura, Euthyneura, Heterobranchia (subclass), Gastropoda (class), Mollusca (phylum), Lophotrochozoa, Spiralia, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  FSGLMSEGSSLEA
  • Length:  13(87-99)
  • Propeptide:  MLLAKISVVVLLLAIDGTSSSESTDNVVLSSSPDSQKAATSRHKRAPGWGKRSSLNDEDLFADSDSAQELLDSVAALKRAPGWGKRFSGLMSEGSSLEAKRAPGWGKRGQEIDVDEDGSEQEKRAPGWGKRAPGWGKRAPGWGKRAPGWGKRAPGWGKRAPGWGKRSGGDYCETLEKMVDAYIYKAVEVDSRRLADCGSGEGTNEPFRK
  • Signal peptide:  MLLAKISVVVLLLAIDGTSS
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  May function as a peptide transmitter.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q10998-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002466_AF2.pdbhor002466_ESM.pdb

Physical Information

Mass: 152864 Formula: C55H87N13O22S
Absent amino acids: CDHIKNPQRTVWY Common amino acids: S
pI: 3.61 Basic residues: 0
Polar residues: 6 Hydrophobic residues: 4
Hydrophobicity: 23.85 Boman Index: -836
Half-Life / Aliphatic Index: 1.1 hour Aliphatic Index: 67.69
Instability Index: 7266.15 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  8844763
  • Title:  Purification, Primary Structure, and Neuronal Localization of Cerebral Peptide 1 From Aplysia