General Information

  • ID:  hor002444
  • Uniprot ID:  P61849
  • Protein name:  Myosuppressin
  • Gene name:  Ms
  • Organism:  Drosophila melanogaster (Fruit fly)
  • Family:  Myosuppressin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  melanogaster subgroup, melanogaster group, Sophophora (subgenus), Drosophila (genus), Drosophilini (tribe), Drosophilinae (subfamily), Drosophilidae (family), Ephydroidea (superfamily), Acalyptratae, Schizophora, Cyclorrhapha, Eremoneura, Muscomorpha (infraorder), Brachycera (suborder), Diptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005184 neuropeptide hormone activity; GO:0071855 neuropeptide receptor binding
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0008344 adult locomotory behavior; GO:0010459 negative regulation of heart rate; GO:0045822 negative regulation of heart contraction; GO:0045986 negative regulation of smooth muscle contraction; GO:0060457 negative regulation of digestive system process
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  TDVDHVFLRF
  • Length:  10(87-96)
  • Propeptide:  MSFAQFFVACCLAIVLLAVSNTRAAVQGPPLCQSGIVEEMPPHIRKVCQALENSDQLTSALKSYINNEASALVANSDDLLKNYNKRTDVDHVFLRFGKRR
  • Signal peptide:  MSFAQFFVACCLAIVLLAVSNTRA
  • Modification:  T10 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Inhibit spontaneous contraction of muscles
  • Mechanism:  NA
  • Cross BBB:  NO
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P61849-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor002444_AF2.pdbhor002444_ESM.pdb

Physical Information

Mass: 140912 Formula: C58H85N15O16
Absent amino acids: ACEGIKMNPQSWY Common amino acids: DFV
pI: 5.41 Basic residues: 2
Polar residues: 1 Hydrophobic residues: 5
Hydrophobicity: 24 Boman Index: -2063
Half-Life: 7.2 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 97
Instability Index: 1323 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  1390001
  • Title:  Isolation and Structural Characterization of Drosophila TDVDHVFLRFamide and FMRFamide-containing Neural Peptides.
  • PubMed ID:  12171930
  • Title:  Peptidomics of the Larval Drosophila Melanogaster Central Nervous System