General Information

  • ID:  hor002424
  • Uniprot ID:  Q172S5
  • Protein name:  Myosuppressin
  • Gene name:  NA
  • Organism:  Aedes aegypti (Yellowfever mosquito) (Culex aegypti)
  • Family:  Myosuppressin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Stegomyia (subgenus), Aedes (genus), Aedini (tribe), Culicinae (subfamily), Culicidae (family), Culicoidea (superfamily), Culicomorpha (infraorder), Nematocera (suborder), Diptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  NA

Sequence Information

  • Sequence:  TDVDHVFLRF
  • Length:  10
  • Propeptide:  MLRTESMSILFCAVLILNITLITCQATTAVPPICENELIEEMPHRIRKVCAALENSNQFAEALNAYIRKEAAALLYQGEDLLAPSSNGKRTDVDHVFLRFGRKR
  • Signal peptide:  MLRTESMSILFCAVLILNITLITCQA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Inhibit spontaneous contraction of muscles
  • Mechanism:  NA
  • Cross BBB:  NO
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q172S5-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002424_AF2.pdbhor002424_ESM.pdb

Physical Information

Mass: 140912 Formula: C58H85N15O16
Absent amino acids: ACEGIKMNPQSWY Common amino acids: DFV
pI: 5.41 Basic residues: 2
Polar residues: 1 Hydrophobic residues: 5
Hydrophobicity: 24 Boman Index: -2063
Half-Life: 7.2 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 97
Instability Index: 1323 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  20163154
  • Title:  Neuropeptidomics of the Mosquito Aedes Aegypti