General Information

  • ID:  hor002421
  • Uniprot ID:  B0JDQ0
  • Protein name:  Myosuppressin
  • Gene name:  FLRFa
  • Organism:  Spodoptera littoralis (Egyptian cotton leafworm)
  • Family:  Myosuppressin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Spodoptera (genus), Amphipyrinae (subfamily), Noctuidae (family), Noctuoidea (superfamily), Obtectomera, Ditrysia, Heteroneura (parvorder), Neolepidoptera (infraorder), Glossata (suborder), Lepidoptera (order), Amphiesmenoptera (superorder), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  NA

Sequence Information

  • Sequence:  QDVVHSFLRF
  • Length:  10(69-78)
  • Propeptide:  LHLCAGAALCAPAQLCGGAADDDPRAARFCQALNTFLELYAEAAGEQVPEYQALVRDYPQLLDTGMKRQDVVHSFLRFGRRR
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Inhibit contractions of different visceral muscles;stimulate certain skeletal muscles;activate enzyme secretion from the gut;represses feeding
  • Mechanism:  NA
  • Cross BBB:  NO
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-B0JDQ0-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002421_AF2.pdbhor002421_ESM.pdb

Physical Information

Mass: 140813 Formula: C58H86N16O15
Absent amino acids: ACEGIKMNPTWY Common amino acids: FV
pI: 7.55 Basic residues: 2
Polar residues: 1 Hydrophobic residues: 5
Hydrophobicity: 23 Boman Index: -1828
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 97
Instability Index: 4752 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  18374428
  • Title:  Antifeeding Properties of Myosuppressin in a Generalist Phytophagous Leafworm, Spodoptera Littoralis (Boisduval)