General Information

  • ID:  hor002405
  • Uniprot ID:  O18845
  • Protein name:  Motilin-associated peptide
  • Gene name:  MLN
  • Organism:  Ovis aries (Sheep)
  • Family:  Motilin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Ovis (genus), Caprinae (subfamily), Bovidae (family), Pecora (infraorder), Ruminantia (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  SLSVQQRSEEVGPVDPAEPREEKQEVIKLTAPVEIGMRMNSRQLEKYQATLEGLLRKALPSSRNAQ
  • Length:  66(50-115)
  • Propeptide:  MLSRKATAILLVVHAAAMLASQTEGFVPIFTYGEVQRMQEKERYKGQKKSLSVQQRSEEVGPVDPAEPREEKQEVIKLTAPVEIGMRMNSRQLEKYQATLEGLLRKALPSSRNAQ
  • Signal peptide:  MLSRKATAILLVVHAAAMLASQTEG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Plays an important role in the regulation of interdigestive gastrointestinal motility and indirectly causes rhythmic contraction of duodenal and colonic smooth muscle.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  MLNR
  • Target Unid:  W5PF20
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P01015-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    AF-P01015-F1.pdbhor002405_AF2.pdbhor002405_ESM.pdb

Physical Information

Mass: 857798 Formula: C317H534N96O104S2
Absent amino acids: CFHW Common amino acids: E
pI: 6.84 Basic residues: 10
Polar residues: 14 Hydrophobic residues: 19
Hydrophobicity: -80.15 Boman Index: -17288
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 82.73
Instability Index: 6997.58 Extinction Coefficient cystines: 1490
Absorbance 280nm: 22.92

Literature

  • PubMed ID:  9427564
  • Title:  Isolation and Sequencing of the cDNA Encoding the Motilin Precursor From Sheep Intestine