General Information

  • ID:  hor002395
  • Uniprot ID:  O18811
  • Protein name:  Motilin
  • Gene name:  MLN
  • Organism:  Macaca mulatta (Rhesus macaque)
  • Family:  Motilin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Macaca (genus), Cercopithecinae (subfamily), Cercopithecidae (family), Cercopithecoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0031788 motilin receptor binding
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  FVPIFTYGELQRMQEKERSKGQ
  • Length:  22(26-47)
  • Propeptide:  MVSRKAVAALLVVHAPAMLASQTEAFVPIFTYGELQRMQEKERSKGQKKSLSVWQRSGEEGPVDPAEPIEEEGNEMIKLTAPLEIGMRMNSRQLEKYRAALEGLLSEMLPQHAAK
  • Signal peptide:  MVSRKAVAALLVVHAPAMLASQTEA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Plays an important role in the regulation of interdigestive gastrointestinal motility and indirectly causes rhythmic contraction of duodenal and colonic smooth muscle.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  MLNR
  • Target Unid:  A0A5F7ZQL0
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P01143-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    AF-P01143-F1.pdbhor002395_AF2.pdbhor002395_ESM.pdb

Physical Information

Mass: 304679 Formula: C119H187N33O35S
Absent amino acids: ACDHNW Common amino acids: EQ
pI: 9.25 Basic residues: 4
Polar residues: 5 Hydrophobic residues: 5
Hydrophobicity: -104.55 Boman Index: -6003
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 48.64
Instability Index: 4727.27 Extinction Coefficient cystines: 1490
Absorbance 280nm: 70.95

Literature

  • PubMed ID:  9762897
  • Title:  Isolation and Sequence of cDNA Encoding the Motilin Precursor From Monkey Intestine. Demonstration of the Motilin Precursor in the Monkey Brain